Harmony Gold Mining

ISIN US4132163001

WKN 864439

Marktkapitalisatie (in EUR)

9.978 m

Land

Zuid-Afrika

Sector

Niet-Energetische Materialen

Dividendrendement

1,85%

Overzicht

Koers

Beschrijving

Harmony Gold Mining Co. Ltd. is een goudmijn- en exploratiebedrijf van wereldklasse met een koperen voetafdruk. Het bedrijf heeft negen diepgelegen mijnen, een open mijnbouwoperatie en verschillende oppervlaktewinningsfaciliteiten. Het bedrijf is actief in de volgende segmenten: Tshepong North, Tshepong South, Moab Khotsong, Joel, Doornkop, Target 1, Kusasalethu, Masimong, Mponeng, Mine Waste Solutions en Hidden Valley. Het bedrijf werd opgericht op 25 augustus 1950 en heeft zijn hoofdkantoor in Randfontein, Zuid-Afrika.

Toon meer Toon minder

Niet-Energetische Materialen Mijnbouw en Minerale Producten Metaalerts Mijnbouw Zuid-Afrika

Grafiek

Financiële kerngegevens

Kerncijfers

Marktkapitalisatie, EUR	9.978 m
WPA, EUR	-
KBV	3,5
K/W	12,0
Dividendrendement	1,85%

Winst- en verliesrekening (2025)

Omzet, EUR	3.976 m
Netto-inkomen, EUR	729 m
Winstmarge	18,33%

In welke ETF zit Harmony Gold Mining?

Er zijn 2 ETF's die Harmony Gold Mining bevatten. Al deze ETF's staan in de tabel hieronder. De ETF met de grootste weging van Harmony Gold Mining is de iShares Gold Producers UCITS ETF.

ETF	Weging	Investeringsfocus	Fondsgrootte (in m EUR)
iShares Gold Producers UCITS ETF	1,01%	Aandelen Wereld Grondstoffen Goudwinning	3.689
Goldman Sachs Alpha Enhanced Emerging Markets Equity Active UCITS ETF USD (Acc)	0,18%	Aandelen Opkomende markten Sociaal/Milieu	302

Prestaties

Rendementsoverzicht

YTD	-14,05%
1 maand	+6,33%
3 maanden	-12,81%
6 maanden	+6,18%
1 jaar	+11,27%
3 jaar	+214,79%
5 jaar	+258,91%
Since inception	+622,97%
2025	+123,95%
2024	+38,20%
2023	+74,77%
2022	-6,88%

Maandelijks rendement in een heat map

Risico

Risk metrics in this section:

Volatility, annualised, measured for 1, 3 and 5 year periods. The annualised volatility reflects the degree of price fluctuations during a one year period. The higher the volatility, the more significantly the price of the asset (stock, ETF, etc.) has changed in the past. Assets with higher volatility are generally considered more risky. We calculate the volatility based on the data for the past 1, 3 and 5 years so that you can see if price fluctuations for the ETF became stronger or weaker over time.
Return per risk for 1, 3 and 5 year periods. This is the annualised (i.e. converted to a one year period) past return divided by the past annualised volatility. The metric puts the historical return of an asset in relation to its historical risk and gives you a retrospective indication of the degree of price fluctuation you had to bear with in order to obtain the return. We calculate this parameter for 1, 3 and 5 year periods to display its evolution over time.
Maximum drawdown for a period. This shows the worst possible loss an investor could have suffered during the respective period, by first buying and subsequently selling the asset at the least favourable prices. For example, if there was the following sequence of daily ETF prices: 10€, 5€, 12€, 20€, an investor would have suffered the worst loss by buying for 10€ and subsequently selling for 5€. Therefore in this case the maximum drawdown would be (5€ - 10€)/10€ = -50%.

ETF-rendementen zijn inclusief dividenduitkeringen (indien van toepassing).