Harmony Gold Mining

ISIN US4132163001

 | 

WKN 864439

Marktkapitalisatie (in EUR)
11.867 m
Land
Zuid-Afrika
Sector
Niet-Energetische Materialen
Dividendrendement
0,76%
 

Overzicht

Koers

Beschrijving

Harmony Gold Mining Co. Ltd. is een goudmijn- en exploratiebedrijf van wereldklasse met een koperen voetafdruk. Het bedrijf heeft negen diepgelegen mijnen, een open mijnbouwoperatie en verschillende oppervlaktewinningsfaciliteiten. Het bedrijf is actief in de volgende segmenten: Tshepong North, Tshepong South, Moab Khotsong, Joel, Doornkop, Target 1, Kusasalethu, Masimong, Mponeng, Mine Waste Solutions en Hidden Valley. Het bedrijf werd opgericht op 25 augustus 1950 en heeft zijn hoofdkantoor in Randfontein, Zuid-Afrika.
Toon meer Toon minder
Niet-Energetische Materialen Mijnbouw en Minerale Producten Metaalerts Mijnbouw Zuid-Afrika

Grafiek

Financiële kerngegevens

Kerncijfers

Marktkapitalisatie, EUR 11.867 m
WPA, EUR -
KBV 5,0
K/W 17,1
Dividendrendement 0,76%

Winst- en verliesrekening (2025)

Omzet, EUR 3.976 m
Netto-inkomen, EUR 729 m
Winstmarge 18,33%

In welke ETF zit Harmony Gold Mining?

Er zijn 1 ETF's die Harmony Gold Mining bevatten.
ETF Weging Investeringsfocus Fondsgrootte (in m EUR)
iShares Gold Producers UCITS ETF 1,46%
Aandelen
Wereld
Grondstoffen
Goudwinning
4.889

Prestaties

Rendementsoverzicht

YTD +3,98%
1 maand -8,28%
3 maanden +18,47%
6 maanden +34,12%
1 jaar +72,45%
3 jaar +545,94%
5 jaar +447,31%
Since inception +774,64%
2025 +123,95%
2024 +38,20%
2023 +74,77%
2022 -6,88%

Maandelijks rendement in een heat map

Risico

Risk metrics in this section:
 
  • Volatility, annualised, measured for 1, 3 and 5 year periods. The annualised volatility reflects the degree of price fluctuations during a one year period. The higher the volatility, the more significantly the price of the asset (stock, ETF, etc.) has changed in the past. Assets with higher volatility are generally considered more risky. We calculate the volatility based on the data for the past 1, 3 and 5 years so that you can see if price fluctuations for the ETF became stronger or weaker over time.
  • Return per risk for 1, 3 and 5 year periods. This is the annualised (i.e. converted to a one year period) past return divided by the past annualised volatility. The metric puts the historical return of an asset in relation to its historical risk and gives you a retrospective indication of the degree of price fluctuation you had to bear with in order to obtain the return. We calculate this parameter for 1, 3 and 5 year periods to display its evolution over time.
  • Maximum drawdown for a period. This shows the worst possible loss an investor could have suffered during the respective period, by first buying and subsequently selling the asset at the least favourable prices. For example, if there was the following sequence of daily ETF prices: 10€, 5€, 12€, 20€, an investor would have suffered the worst loss by buying for 10€ and subsequently selling for 5€. Therefore in this case the maximum drawdown would be (5€ - 10€)/10€ = -50%.
ETF-rendementen zijn inclusief dividenduitkeringen (indien van toepassing).
Toon meer Toon minder

Risico-overzicht

Volatiliteit 1 jaar 60,68%
Volatiliteit 3 jaar 54,31%
Volatiliteit 5 jaar 53,73%
Rendement/Risico 1 jaar 1,19
Rendement/Risico 3 jaar 1,59
Rendement/Risico 5 jaar 0,75
Maximaal waardedaling 1 jaar -31,24%
Maximaal waardedaling 3 jaar -33,75%
Maximaal waardedaling 5 jaar -57,87%
Maximaal waardedaling sinds aanvang -65,95%

Voortschrijdende volatiliteit over 1 jaar

— Gegevens verstrekt door Trackinsight, etfinfo, Xignite Inc., gettex, FactSet en justETF GmbH.

Standaard zijn ETF-rendementen inclusief dividenduitkeringen (indien van toepassing). Er is geen garantie voor de volledigheid, juistheid en correctheid van de getoonde informatie.